PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000192108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 1829aa    MW: 205554 Da    PI: 5.0663
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000192108genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-183085257
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR+  t+ qle+Le++++ + yps++ r+eL++klgL++rq ++WF+ rR k+kk
  MDP0000192108 30 PKRQMKTPFQLETLEKAYALETYPSEAIRAELSEKLGLSDRQLQMWFCHRRLKDKK 85
                   69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-18886IPR009057Homeodomain-like
SuperFamilySSF466891.71E-161686IPR009057Homeodomain-like
PROSITE profilePS5007116.6822686IPR001356Homeobox domain
SMARTSM003894.2E-182890IPR001356Homeobox domain
PfamPF000465.0E-163085IPR001356Homeobox domain
CDDcd000863.05E-143186No hitNo description
SMARTSM005714.8E-22616675IPR018501DDT domain
PROSITE profilePS5082716.96616675IPR018501DDT domain
PfamPF027913.0E-17618672IPR018501DDT domain
PfamPF050669.5E-15797865IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.9E-610161060IPR028942WHIM1 domain
PfamPF156138.6E-1411991271IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1829 aa     Download sequence    Send to blast
MEAASEGENQ NKNHESNSKL NNSSEGQSKP KRQMKTPFQL ETLEKAYALE TYPSEAIRAE  60
LSEKLGLSDR QLQMWFCHRR LKDKKEGGPP KKQRKLVAAL PEPPIDDLAH GSEPGSDYGS  120
GSGSGSSPFG HAELRNVVAR GVADDIPMRG RRYYESPQSI LELRAIACVE AQLGEPLRED  180
GPLLGIEFDP LPPDAFGAPL GQLSNALYLT YVGLDCNIIQ RILCILLFSV LYFSNHALCK  240
FSDIQITLAT QFHANPFDSL LGEAVAEQHK RSAHALEGKY ERHDAKPIKN EFSSQATPRA  300
IHEYPFLQDH SSIRSDAYGQ VSQSHFHDSA IDGPTARTSS FAVGNEPLSR VHGVHGHASR  360
VRLLSQQERQ VVPYSSPVDD GSVAQRDSFT NVRVNTQFSD PPVVAPALEN SNVLSEGQIN  420
DSILRMERKR KSEEARIAKE VEAHELRIRK ELEKQDILRR KNEERMRKEM EKQDRERRKE  480
EERLMRERQR EEERLKREQK REIERREKFL QKEYIRAEKX RQKEELRKER EVVKRKAALE  540
KATARRLAKE SMELIEDEQL ELMELAATSK GLSSIICIDL DTLQNLDAFR DSLVAFPPRS  600
VQLKRPFTIQ PWINSEANIG NLLMVWRFLI TFADVLELWP FTLDEFVQAF HDYDSRLLGE  660
IHVALLRLII KDIEDVARTP TGLGINQNGA ANPGGGHPQI VEGAYAWGFD IRNWQQHLSL  720
LTWPEIFRQL ALSAGFGPQL KKRSIAWSYT PDNHEGKGCQ DAISNLRNGS AAVNAFAVMQ  780
EKGLLAPRRS RHRLTPGTVK FAAFHVLSLE GNKGLTVLDL ADKIQKSGLR DLTTSKTPEA  840
SISVALTRDT KLFERIAPST YRVRAAYRKD PDDAEAILSA ARKKIQIFEN GILAAEDVDD  900
VERDDVENDE VERDEDSECE VDEDPEVDDL ATPSVAKKSP DDYNEVISFS ENGKDSLSND  960
VGLAVKNEFD KDVLCSSLTG SKDAFCPSAS SKQCVLGADI STSHLDQENM EIDESKSGES  1020
WVQGLTEGEY SDLSVEERLS GLVALIGVAN EGNTIRVVLE DRLEAANALK KQMWAEAQLD  1080
KSRLKEENVG RLDFPSLMGG KAEVQATGVE DGLSPLRDVD NRNIDASPVT AENEKSIHGS  1140
QGVQNQLNGV HGERTSAAQD ISMGSDNFLT QQLAYASKRS RSQLKSYIAH RAEEMFAYRS  1200
LPLGQDRRHN RYWQFVASAS RHDPGSGRIF IELNNGSWRL IDTEEAFDAL VTSLDARGIR  1260
ESHLRLMLQK IEASFKENVQ KNTHRPNNAG PSKNHVXDEA DEMDSSPDFP SHFDSPESAV  1320
CALNSDTAQT SSSFXIELDR SETEKRAALR RYQDFQKWMW KECSNSSTLC ATKYGKERCR  1380
PLFDVCDVCL NCYYFEDSHC YTCHQTFDAF NRNFDFGEHV MQCKEKRMLE PWNFDIPCTS  1440
LPLARRLLKT LIALVEVSIP PEALQLSWTD DRRKMWGEKL NASSSMDELL QILTLVETAV  1500
KKDFLSSHFA VTEELLGSCK QPGVVRDYLX SGSVPVLPWI PHTTAAVALR LLEIDSSITY  1560
VKQAKAEPTT DKEVGEYLNQ PMRLPTSRSE TELTEAGLNE YMREENSTHL KSGRNSFRRG  1620
RGGREQGRGK RWQKKVSNPK SVASRQNIRG NENLNQGLRT VGKRTQGQGS GRGRRTVRKR  1680
RMKNRAVEGT PLGRVSXMRS SPESGGESPR NLAEEWDDEK IDMRGDEQGE GFERVDALES  1740
EDDDQAVGYE QGNWEIGFDG TSSGWNGGLV EASDDDIDAS EDDNNVMEEV RDEDSEGDVD  1800
MSDASDEMLP NTMRNDDGTE SESSDDSSE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17885RRLKDKKE
2494500LKREQKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.91110.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371415.10.0PREDICTED: uncharacterized protein LOC103434833 isoform X2
TrEMBLM5X2Q20.0M5X2Q2_PRUPE; Uncharacterized protein
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1